PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00022.209
Common NameAMTR_s00022p00190540
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family G2-like
Protein Properties Length: 411aa    MW: 45972.3 Da    PI: 7.3651
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00022.209genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.42.4e-31230284155
                                   G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                               k+r+rWt+eLHe+Fve v++LGG+ kAtPk+il+ m+ +gLt++hvkSHLQkYR+
  evm_27.model.AmTr_v1.0_scaffold00022.209 230 KTRMRWTQELHEKFVESVNRLGGAGKATPKAILQQMGSEGLTIYHVKSHLQKYRS 284
                                               68****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.0E-28227285IPR009057Homeodomain-like
PROSITE profilePS5129411.503227287IPR017930Myb domain
SuperFamilySSF466891.4E-16228284IPR009057Homeodomain-like
TIGRFAMsTIGR015576.3E-23230285IPR006447Myb domain, plants
PfamPF002492.3E-10232283IPR001005SANT/Myb domain
PfamPF143797.2E-23312358IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 411 aa     Download sequence    Send to blast
MNSQKIECPE ENFPASNNYS FFSPQINIKQ GNSQSPDAFS FSNGSLAPPP VTHQLPCSFS  60
SSNYFGLLPF SRYTNDRLMG FSHYDSLSPT PTKNSLGGSL PQFSVDSRKE TNNNIGSFDN  120
SQYVMGFPLL GEHCVKTTSY CNLNQQKDSK RSEFYPSLPI DGSDVDVSLP RRHLLAIEGI  180
QNCLGNLQSS NCSTTELAFQ NQQERCFSSC HVGTSVASTH VTCGVGASNK TRMRWTQELH  240
EKFVESVNRL GGAGKATPKA ILQQMGSEGL TIYHVKSHLQ KYRSAKYLPD AAEGKLERKT  300
TNDIRHDLKT GIQITEALRM QMDVQRRLHE QLEIQRKLQL QIEEHGKYLQ KMVDQQQKRS  360
ENLFGSHNIN VLYSEKQPIN LAGVIESSFD DELLDKTPSR FSLGDGQSHE *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011625513.10.0PREDICTED: uncharacterized protein LOC18439809
TrEMBLW1PWA80.0W1PWA8_AMBTC; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP7817262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.11e-59G2-like family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]